DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp5

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_031581.2 Gene:Bmp5 / 12160 MGIID:88181 Length:454 Species:Mus musculus


Alignment Length:439 Identity:101/439 - (23%)
Similarity:164/439 - (37%) Gaps:133/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 HLRIEFVKQQILEKLRLKE-----SPKVSAVELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKK 308
            |.|.| ::::||..|.|..     ||...|...|..:.|   |.:...|..|.|..:|..|.|  
Mouse    46 HERRE-IQREILSILGLPHRPRPFSPGKQASSAPLFMLD---LYNAMASEDNPEESEYLVRVS-- 104

  Fly   309 FILLNREEVECNRARDGKSN---------------------PSMCFTFKIDDAD----------- 341
               |..|..|..:......|                     .|:..|..::|||           
Mouse   105 ---LAGEAKETRKGYPASPNGYAHRLHLPPRTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVER 166

  Fly   342 ---------------------AEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEV-- 383
                                 ..|..|:.|...::|:|.|.        ....:||.:|..::  
Mouse   167 DKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDKGNH--------RFENETIKISIYQIIK 223

  Fly   384 ---DQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEE 445
               ::..|...|...||   |:::|  .|:..||.....||:...:.:..:|:    |..:....
Mouse   224 EYTNRDADLFLLDTRKT---QALDV--GWLVFDITVTSNHWVINPQNNLGLQL----CAETGDGR 279

  Fly   446 IISV----------DKDYRPFIVI------------------DMQNRRR-KSRQKRSINCSSG-- 479
            .|:|          .:..:||:|.                  ..|||.: .|.|..|...|:|  
Mouse   280 SINVKSAGLVGRHGPQSKQPFMVAFFKASEVLLRSVRAASKRKNQNRNKSNSHQDPSRMPSAGDY 344

  Fly   480 ----MTECCREH-LYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHS---SIMKIL 536
                ..:.|::| ||:||||:||.:||:.||||.|::|.|.||...:....|::|:   :::.::
Mouse   345 NTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLM 409

  Fly   537 STSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            ......|     |||...:.:::.::..|.|:...:|...||||.||||
Mouse   410 FPDHVPK-----PCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGC 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 54/281 (19%)
TGF_beta 481..585 CDD:278448 36/107 (34%)
Bmp5NP_031581.2 TGFb_propeptide 31..304 CDD:279078 55/283 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..347 8/28 (29%)
TGF_beta 351..453 CDD:278448 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.