DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and Bmp3

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001297606.1 Gene:Bmp3 / 110075 MGIID:88179 Length:470 Species:Mus musculus


Alignment Length:373 Identity:66/373 - (17%)
Similarity:119/373 - (31%) Gaps:144/373 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 NITISVKSSAGGCPK---CESNRQVEHI------------TEEQLTHLRIEFVK----------- 256
            ||::|       ||:   |..:.|.:||            ..:.|.||.::.|:           
Mouse   139 NISLS-------CPEPQGCSHHTQRQHIQIDLSAWILKSNQSQLLGHLSVDVVRPYRDSVSWLSK 196

  Fly   257 --QQILEKLRLKESPKVS------AVELPKPIF-----------DGMTLSHPDDSTKNKELD-DY 301
              .|:|.|.:..|...:.      |.||||.:.           :...:|.|:....:.:.. |:
Mouse   197 DITQLLRKAKQNEEFLIGFNITSRAHELPKRMLFFPEPYILVYANDAAISEPESVVSSLQRHRDF 261

  Fly   302 YARTSKKFILLNREEVECNRARDGKSNPSMCFTFKIDDADAEGFDVSTAVLW----LFKNKQNRT 362
            .|.|..:.....||.:...|.:  |.:..:....:.::.....:.......|    .:|:.|.:.
Mouse   262 TAGTGPRLDSHVREALSVERRK--KRSTGILLPLQNNELPGAEYQYKEEGAWEERKPYKSLQTQP 324

  Fly   363 DTASVNSTSAQQTIVVSEVEVDQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISGHEL 427
            ...|.|...             |:|.|                                   |:.
Mouse   325 PEKSRNKKK-------------QRKGS-----------------------------------HQK 341

  Fly   428 SHLIQITCGGCDVSDMEEIISVDKDYRPFIVIDMQNRRRKSRQKRSINCSSGMTECCREHLYISF 492
            ...:|..                           :...:|:|:|:.:.    ...|.|.:|.:.|
Mouse   342 GQTLQFD---------------------------EQTLKKARRKQWVE----PRNCARRYLKVDF 375

  Fly   493 RDIGWSNWILKPEGYNAYFCRGSCS----SVASVTQAASHHSSIMKIL 536
            .|||||.||:.|:.::|::|.|:|.    .||:.  ||:.|..::..|
Mouse   376 ADIGWSEWIISPKSFDAFYCSGACQFPMPKVAAA--AAALHLVLISFL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 32/248 (13%)
TGF_beta 481..585 CDD:278448 22/60 (37%)
Bmp3NP_001297606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..349 9/109 (8%)
TGF_beta 364..>424 CDD:278448 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11848
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.