DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and nodal5

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002945280.2 Gene:nodal5 / 100495007 XenbaseID:XB-GENE-483267 Length:386 Species:Xenopus tropicalis


Alignment Length:186 Identity:45/186 - (24%)
Similarity:78/186 - (41%) Gaps:36/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 QITCGGCDVSD--MEEIISVDK---------------DYRPFIVIDMQNR----RRKSRQKRSIN 475
            :|:|.|. :|:  |..:.|.||               :...:::.:...|    ||..|.:.::|
 Frog   204 KISCNGL-LSERIMLMVFSTDKPSSKLTGSTSLIETAESSKYVITEADTRETGKRRHRRNRYALN 267

  Fly   476 -----------CSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHH 529
                       ...|.|.|.|..:.:.|..||||:.|:.|:.:|||.|.|||....:.....::|
 Frog   268 SIIRSSFHSQPVGDGKTLCRRVDMIVDFEKIGWSDRIIYPKRFNAYRCEGSCPIPLNENFKPTNH 332

  Fly   530 SSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            :.|..::  :..|......|.|...:...|.: :|...:...:|...:|:||.|||
 Frog   333 AYIKSLV--NHFNPGRVECPSCIPVKMRPLSM-LMYEGDEIVLKHHEDMIVEECGC 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 8/42 (19%)
TGF_beta 481..585 CDD:278448 29/103 (28%)
nodal5XP_002945280.2 TGFb_propeptide 51..186 CDD:366248
TGF_beta_NODAL 284..385 CDD:381637 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.