DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and bmp5

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_004914553.1 Gene:bmp5 / 100494976 XenbaseID:XB-GENE-479371 Length:449 Species:Xenopus tropicalis


Alignment Length:308 Identity:71/308 - (23%)
Similarity:129/308 - (41%) Gaps:62/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 RARDGKSNPSMCFTFKIDDAD-AEGFDVSTAVLWLFKNKQNRTDTASVNSTSAQQTIVVSEVEV- 383
            |.:|...|......|:.|... ..|..|:.|...::|::.        |:....:|:.:|..:: 
 Frog   160 RDKDFSHNRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRS--------NNRFGNETLKISIYQII 216

  Fly   384 -DQQKDSKYLSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEEII 447
             |.......|....|..:|:.:|  .|:..||.....||:...:.:..:|:    |..:.....:
 Frog   217 KDYSNRDADLFLLDTQRVQTYDV--GWLVFDITVTSNHWVINPQNNLGLQL----CAETSDGRSV 275

  Fly   448 SV----------DKDYRPFIV------------IDMQNRRRKSRQKRSINCS------------- 477
            ||          .:..:||:|            :...|.::|.:.:.....|             
 Frog   276 SVKSAGLIGRHGPQSKQPFLVAFFKASEVLLRSVRATNTKKKKQDRNKSTTSHDASRMPSIGDYN 340

  Fly   478 -SGMTECCREH-LYISFRDIGWSNWILKPEGYNAYFCRGSCSSVASVTQAASHHS---SIMKILS 537
             |...:.|::| ||:||||:||.:||:.||||.|::|.|.||...:....|::|:   :::.::.
 Frog   341 TSEQKQACKKHELYVSFRDLGWEDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMF 405

  Fly   538 TSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNMVVESCGC 585
            .....|     |||...:.:::.::..|.|:...:|...||||.||||
 Frog   406 PDHVPK-----PCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGC 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 28/149 (19%)
TGF_beta 481..585 CDD:278448 36/107 (34%)
bmp5XP_004914553.1 TGFb_propeptide 27..298 CDD:366248 29/151 (19%)
TGF_beta_BMP5 337..449 CDD:381665 39/117 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.