DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment daw and inhbb

DIOPT Version :9

Sequence 1:NP_001259967.1 Gene:daw / 33474 FlyBaseID:FBgn0031461 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_031749407.1 Gene:inhbb / 100124901 XenbaseID:XB-GENE-5762104 Length:368 Species:Xenopus tropicalis


Alignment Length:397 Identity:98/397 - (24%)
Similarity:167/397 - (42%) Gaps:93/397 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 GCPKCESNRQVEHITEEQLTHLRIEFVKQQILEKLRLKESPK----------VSAV--------- 274
            |||.|....:.|          .:|.||:.||..|::::.|.          |||:         
 Frog    24 GCPSCHPPMEPE----------MLEAVKRHILSLLQMQDRPNITHTVPRAAMVSALRKLHAGRVR 78

  Fly   275 ---ELPKPIFDGMTLSHPDDSTKNKELDDYYARTSKKFILLNREEVECNRARDGKSNPSMCFTFK 336
               .|..|..||.:|..|.:|.::......:|.|         ::|..:|.|         .:|.
 Frog    79 DDGNLEIPDMDGHSLPPPGNSAESSAEIISFAET---------DDVTASRVR---------LSFA 125

  Fly   337 IDDADAEGFDVSTAVLWLF------KNKQNRTDTASVNSTSA----QQTIVVSEVEVDQQKDSKY 391
            |.:...:...|..:.|||:      .:|..|.....|:...|    :..:|..:|::   :.|.:
 Frog   126 IANEGNQNLLVFQSNLWLYLKLPEVMDKSRRKIRIKVHFQDAFNPGKTNVVEKKVDI---RRSGW 187

  Fly   392 LSAAKTIAIQSVNVQDEWMKIDIEWPIKHWISGHELSHLIQITCGGCDVSDMEEIISV-----DK 451
            .:...|.|:||:..:.| .::::|                 :.|.||   ....:|.|     ::
 Frog   188 HTFPLTEAVQSLFEEGE-RRLNLE-----------------VQCDGC---GEYSVIPVYVDPGEE 231

  Fly   452 DYRPFIVIDMQNRRRKSR-QKRSINCSSGMTECCREHLYISFRDIGWSNWILKPEGYNAYFCRGS 515
            .:|||:|:..:....|.| :||.:.|......|||:..||.||.|||::||:.|.||...:|.||
 Frog   232 SHRPFLVVHARLADNKHRIRKRGLECDGRTNLCCRQQFYIDFRLIGWNDWIIAPAGYYGNYCEGS 296

  Fly   516 CSS-VASVT-QAASHHSSIMKILSTSGANKSLELVPCCTAKQYSSLQLVVMDSSNTATVKTLPNM 578
            |.: :|.|. .|:|.|::::......|.|.. .:..||...:.|::.::..|.......:.:|||
 Frog   297 CPAYLAGVPGSASSFHTAVVNQYRMRGLNPG-TVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNM 360

  Fly   579 VVESCGC 585
            :||.|||
 Frog   361 IVEECGC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dawNP_001259967.1 TGFb_propeptide 244..458 CDD:279078 49/250 (20%)
TGF_beta 481..585 CDD:278448 36/105 (34%)
inhbbXP_031749407.1 TGFb_propeptide 29..239 CDD:413528 50/261 (19%)
TGF_beta_INHBB 262..368 CDD:381675 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385831at2759
OrthoFinder 1 1.000 - - FOG0000887
OrthoInspector 1 1.000 - - otm47597
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.