DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and TCB2

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_014312.1 Gene:TCB2 / 855637 SGDID:S000005031 Length:1178 Species:Saccharomyces cerevisiae


Alignment Length:338 Identity:82/338 - (24%)
Similarity:142/338 - (42%) Gaps:71/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 RTKDGKGKKGVDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQK-------------- 192
            ||.:..||||| ..:|....|.|.......:||..|..|..:::||..:||              
Yeast   757 RTGNLIGKKGV-KGTVTYYLSFYPVVPVLSLEEAKEVDEINEKKDKLEKQKSTLDDKNISKEEKE 820

  Fly   193 -LGRLNFKL--EYD---------------FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPD 239
             :.:..|:|  :||               :|:..|.|||: ..|||...:      ||:.:    
Yeast   821 RIKKEEFRLTEKYDMYSYKMKLDLDELLQYNAGVLGVTVL-GGELPQPGL------YVQTF---- 874

  Fly   240 KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDF------DRFSKHDQIGEVKVP 298
                |::..: ..::...|...|.|:....|.|.|.|.:::..|      |.....:.|.||.:|
Yeast   875 ----FDSCGY-AAITSAKNAIRTIKTGWSGDFMIKELEWSVTTFRVTKTKDANKAENFICEVNIP 934

  Fly   299 LCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICF---------SLRYVPTAGKLTVVILEAKNLKK 354
              ||:|.:.......::::.|:...:.|..:.:         ....:..:|.|.:....|:||..
Yeast   935 --TIELVRNCYYKPSVLNLIGKKSAKLLVQVSWFPVTATELPQSDLITNSGDLKITAKSAENLIG 997

  Fly   355 MDVGGLSDPYVKIAIMQNGKRLKK-KKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYD 418
            ::..|.|||||:..:  |.|.... .||:::|.||||.:|||.:.||. .::... |.:.|.||:
Yeast   998 VNKNGYSDPYVEFFL--NEKSTSPFFKTAVQKKTLNPTWNESKTIEVS-NRVNDY-LTINVKDYE 1058

  Fly   419 RIGTSEPIGRCIL 431
            ...::..||:.::
Yeast  1059 STNSNRSIGKAVV 1071

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 32/161 (20%)
C2B_Synaptotagmin-1 326..461 CDD:176047 32/116 (28%)
TCB2NP_014312.1 COG5038 4..1178 CDD:227371 82/338 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 1 1.000 - - otm46764
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.