DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and TCB1

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_014729.1 Gene:TCB1 / 854253 SGDID:S000005612 Length:1186 Species:Saccharomyces cerevisiae


Alignment Length:304 Identity:73/304 - (24%)
Similarity:129/304 - (42%) Gaps:63/304 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KKRRTKDGKGKKGVDMKSVQLLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYD 203
            :|:.:|:.|.|...:...|:.|...|..:.:.|:.||.:                          
Yeast   820 EKKISKEDKAKFDQEWNEVKELEDMYSNRQKLDLPELLQ-------------------------- 858

  Fly   204 FNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPY 268
            :|...|||||:.. |||      .|..||:.:        |:...|.:.:||....... |:...
Yeast   859 YNQGVLAVTVLNG-ELP------DSGLYVQAF--------FDDNGHPRFVSPRIPSRIV-KNGWS 907

  Fly   269 ADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRD------LVSVEGEGGQEKLG 327
            .|.:.|.|..:|..| |.:|:.....|:..:|.::| .|.|..::      ::.:.|||..:.:.
Yeast   908 GDVIIKELDKSITTF-RVAKNKNYNRVEKCVCEVEL-PTQELVKNCYYKPSILHLSGEGSAKLML 970

  Fly   328 DICF---SLRYVP------TAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSI 383
            .|.:   ..:.:|      .:|.||::...|:||...|:.|.||||:|..|  |.:.....||.:
Yeast   971 QISWFPIDTKQLPANDLITNSGDLTIMSRSAENLIASDLNGYSDPYLKYYI--NNEEDCAYKTKV 1033

  Fly   384 KKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIG 427
            .|.||||.:|:..:.::. .::..: |.:.|:|:|.....:.||
Yeast  1034 VKKTLNPKWNDEGTIQIN-NRLNDV-LRIKVMDWDSTSADDTIG 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 29/129 (22%)
C2B_Synaptotagmin-1 326..461 CDD:176047 31/111 (28%)
TCB1NP_014729.1 COG5038 1..1182 CDD:227371 73/304 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 1 1.000 - - otm46764
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.