DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and DOC2A

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_024306240.1 Gene:DOC2A / 8448 HGNCID:2985 Length:467 Species:Homo sapiens


Alignment Length:381 Identity:116/381 - (30%)
Similarity:158/381 - (41%) Gaps:98/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAE------------------------ 217
            |:..|.|..|......||.|.|.|.||..|.:|..::::|:                        
Human    74 EDGAEVDSYDSDDATALGTLEFDLLYDRASCTLHCSILRAKVGTPCHPSPGPVCVQPPEGAHSSF 138

  Fly   218 ----------------------------ELPA---------------LDMGGTSDPYVKVYLLPD 239
                                        |:|.               :|..|.:|||||::|||.
Human   139 PSQACSFVLPLPPPSGLLQGPALQEGWREVPGASSPLPCPPLQGLKPMDFNGLADPYVKLHLLPG 203

  Fly   240 --KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTI 302
              |..|.:||..|.||:||:||..|:..:...|..:|.|..|:.|.|:.|.::.|||::|||..:
Human   204 ACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDKLSHNEFIGEIRVPLRRL 268

  Fly   303 DLAQ------TIEEWRDLVS---------------------VEGEGGQEKLGDICFSLRYVPTAG 340
            ..:|      .:|....|.|                     .:|:|..|:.|.|..||.|.....
Human   269 KPSQKKHFNICLERQVPLASPSSMSAALRGISCYLKELEQAEQGQGLLEERGRILLSLSYSSRRR 333

  Fly   341 KLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQI 405
            .|.|.||...:|..|||.|.||||||..:..:..:..|.||.:||.||||.:||.|.:|:....:
Human   334 GLLVGILRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTL 398

  Fly   406 QKICLVVTVVDYDRIGTSEP-IGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 460
            ....|.|||.||| ||.|.. ||...||....|...:||||.|..|...:.:||||
Human   399 ATKTLEVTVWDYD-IGKSNDFIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 50/198 (25%)
C2B_Synaptotagmin-1 326..461 CDD:176047 58/136 (43%)
DOC2AXP_024306240.1 C2A_Rabphilin_Doc2 90..280 CDD:176000 48/189 (25%)
C2B_Rabphilin_Doc2 321..453 CDD:176030 55/132 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.