DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and AT3G55470

DIOPT Version :10

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_191107.1 Gene:AT3G55470 / 824713 AraportID:AT3G55470 Length:156 Species:Arabidopsis thaliana


Alignment Length:111 Identity:33/111 - (29%)
Similarity:50/111 - (45%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 GKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFE- 403
            |.|.|.::..|.||:.|..|..||||:|   |...:.:|...:.:....||.:|:...:...|. 
plant     4 GILEVSLISGKGLKRSDFLGKIDPYVEI---QYKGQTRKSSVAKEDGGRNPTWNDKLKWRAEFPG 65

  Fly   404 QIQKICLVVTVVDYDRIGTSEPIGRCILGC-----MGT--GT-ELR 441
            ......|:|.|:|:|...:.:.||...:..     ||.  || |||
plant    66 SGADYKLIVKVMDHDTFSSDDFIGEATVHVKELLEMGVEKGTAELR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Syt1_2_N 62..161 CDD:425364
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031
C2B_Synaptotagmin-1 326..461 CDD:176047 33/111 (30%)
AT3G55470NP_191107.1 C2_putative_Elicitor-responsive_gene 4..128 CDD:176014 33/111 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.