DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and pla2g4f.1

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_021323073.1 Gene:pla2g4f.1 / 798864 ZFINID:ZDB-GENE-131121-408 Length:866 Species:Danio rerio


Alignment Length:88 Identity:27/88 - (30%)
Similarity:45/88 - (51%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAM 272
            :|:|.|::|:...:.|....||.||.:.|.....:...||......:|.:||||||:  .:::..
Zfish    40 NLSVKVLRAKIHQSYDYLNESDCYVILNLPTASARTKRTKTIPSNNNPEWNETFTFR--VFSNIK 102

  Fly   273 NKTLVFAIFDFDRFSKHDQIGEV 295
            | .|...::|.|.|.:.||.|.:
Zfish   103 N-VLEIMVYDEDPFMRDDQCGTI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 27/88 (31%)
C2B_Synaptotagmin-1 326..461 CDD:176047
pla2g4f.1XP_021323073.1 C2_cPLA2 40..159 CDD:176001 27/88 (31%)
cPLA2_Grp-IVB-IVD-IVE-IVF 295..835 CDD:132840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.