DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and syt15

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_009305102.1 Gene:syt15 / 798021 ZFINID:ZDB-GENE-090527-2 Length:435 Species:Danio rerio


Alignment Length:311 Identity:91/311 - (29%)
Similarity:150/311 - (48%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDM 224
            |||     ::||:.:|.|...|....|..:.    ||.|.|.|..:...|.|::::|..||....
Zfish   138 LGS-----IRPDLYQLPEEPSEWALPDGSAV----RLWFALRYQQDKEQLVVSLLRAANLPTQCQ 193

  Fly   225 GGTSDPYVKVYLLP-DKKKKFETKVHRKTLSPVFNETFTFK-SLPYADAMNKTLVFAIFDFDRFS 287
            ...:  .||:.||| |.::..:.|..||...|.||:||.|: |....|..  :|..::|..|...
Zfish   194 RNIT--LVKLQLLPSDDRRHRQAKARRKGCHPQFNDTFVFQVSNSCVDQC--SLNMSLFTVDHQK 254

  Fly   288 KHDQIGEVKVPLCTIDLAQTI--EEWRDLVSVEGEGGQ--EKLGDICFSLRYVPTAGKLTVVILE 348
            ||..:|::.:||...:|.:..  .:||||   :.|..|  .|.|||..||.|..:..:||||:|.
Zfish   255 KHHLMGQILIPLICSELKEAAGKVQWRDL---DNESDQPLSKNGDIQVSLNYNQSLHRLTVVVLR 316

  Fly   349 AKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVT 413
            |:.|:......:.   .|:.:..:.:.::.|.|::.|.. :|.:||..:|.:...|:...||.:.
Zfish   317 ARGLQCCSEAAVC---AKVCLKIHTQVVRNKWTTVAKGN-SPSFNEKLTFRLLPMQLDTACLSLQ 377

  Fly   414 VVDYDRIGTSEPI--GRCILG--CMGTGTELRHWSDMLASPRRPIAQWHTL 460
            :   .:..|.:|:  ...::|  ....|.||.||:||::.|:..:.|||.|
Zfish   378 I---QQPSTEKPVLLAIVVIGPFMYARGRELEHWNDMVSKPQELVRQWHPL 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 40/127 (31%)
C2B_Synaptotagmin-1 326..461 CDD:176047 39/139 (28%)
syt15XP_009305102.1 C2A_Synaptotagmin-15-17 164..285 CDD:176036 40/127 (31%)
C2B_Synaptotagmin-15 294..426 CDD:176054 39/139 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.