DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Pla2g4f

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_008760344.1 Gene:Pla2g4f / 691907 RGDID:1593370 Length:860 Species:Rattus norvegicus


Alignment Length:296 Identity:64/296 - (21%)
Similarity:102/296 - (34%) Gaps:91/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETK 247
            :.|.::::.|..|......||     |.|.|::|..:...|....:|.||:::|........:|:
  Rat    25 ETEKRETQWKHWRQETHPYYD-----LQVKVLRARNIQHTDKLSKADCYVQLWLPTASFSPTQTR 84

  Fly   248 VHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWR 312
            .......|.:||||.::   ...|:...|..|::|.|.... |:|..|...|.|:.|.|.     
  Rat    85 TVVNCSDPEWNETFHYR---IHSAVKNVLELALYDKDVLDS-DKIFSVLFDLSTLQLGQP----- 140

  Fly   313 DLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDP---YVKIA------ 368
                                  |..|.            .:|..  ||:||   .|:..      
  Rat   141 ----------------------YTKTF------------TQKQP--GLTDPKELQVEFTLEKSQM 169

  Fly   369 ----IMQNG-------KRLKKKKTSIKKCTLNPYYNESFSFEVP--FEQIQKICLVVTVVDYDRI 420
                ::.||       .|::...|..|..:|..:.:......||  :|:.|.:.|..|.|     
  Rat   170 PACEVITNGVLVAHPCLRIQGTVTGDKTASLGEFGSREIQLAVPGAYEKPQSVPLQPTTV----- 229

  Fly   421 GTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIA 455
               ||         | ..|.:.|.:.:| |||..||
  Rat   230 ---EP---------GLPATFIFHMNPVL-SPRLNIA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 31/123 (25%)
C2B_Synaptotagmin-1 326..461 CDD:176047 32/153 (21%)
Pla2g4fXP_008760344.1 C2_cPLA2 46..166 CDD:176001 35/164 (21%)
Patatin_and_cPLA2 307..854 CDD:299702
PLAc 313..802 CDD:214474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.