DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Pla2g4d

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_001080051.2 Gene:Pla2g4d / 691905 RGDID:1593372 Length:825 Species:Rattus norvegicus


Alignment Length:151 Identity:42/151 - (27%)
Similarity:74/151 - (49%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMN 273
            |.|.:::|..||..|:...:||||.:.|.....:||:|:....:.:||:||||:|  |..:...|
  Rat    33 LTVKILEARSLPRADLLSKADPYVTLRLPTASGRKFKTQTVTNSSNPVWNETFSF--LIQSQVKN 95

  Fly   274 KTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYV-- 336
             .|...::|.|..:|.|...::...:..|...|.:::   ..|:..:|.:|.  |:.|.:...  
  Rat    96 -ILELTVYDEDLITKDDICFKISYDISEILPGQLVQK---TFSLNPQGPEEL--DVEFLVER
TCD 154

  Fly   337 PTAGKLTVVILEAKNLKKMDV 357
            |....:|..:|.|:.|..:||
  Rat   155 PPENLITNNVLVARELSHLDV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 30/106 (28%)
C2B_Synaptotagmin-1 326..461 CDD:176047 9/34 (26%)
Pla2g4dXP_001080051.2 C2_cPLA2 32..151 CDD:176001 35/125 (28%)
PLAc 267..758 CDD:214474
Patatin_and_cPLA2 278..814 CDD:299702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.