DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and SYT5

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_003171.2 Gene:SYT5 / 6861 HGNCID:11513 Length:386 Species:Homo sapiens


Alignment Length:355 Identity:194/355 - (54%)
Similarity:270/355 - (76%) Gaps:3/355 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LPTWGVVAIIILVFLVVFGIIFFCVRRFLKKRRTKDGKGKKGVDMKSVQLLGSAYKEKVQPDMEE 174
            :|.|.:..|:::..|::|...|...|:..::|..|..:.:..|.::.|:.||.:|.:||||::||
Human    27 VPPWALATIVLVSGLLIFSCCFCLYRKSCRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEE 91

  Fly   175 LTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPD 239
            | |.|..|..:....:.:||||.:.|:|||.|..|.|.::||..|.|||:||:|||||:||||||
Human    92 L-EPAPSGPGQQVADKHELGRLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPD 155

  Fly   240 KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDL 304
            |::::||||||:||:|.|.|||.|| :||.:...:.||.|::||||||::|.||||:||:.::||
Human   156 KRRRYETKVHRQTLNPHFGETFAFK-VPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDL 219

  Fly   305 AQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAI 369
            .:.::.||:|.:...| .||||||||||||||||||||||::||||||||||||||||||||:.:
Human   220 GRPVQAWRELQAAPRE-EQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHL 283

  Fly   370 MQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCM 434
            :|.||:::||||:|||.||||||||:||||||.:|:||:.:.:||:|||::|.:|.|||..:|..
Human   284 LQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAA 348

  Fly   435 GTGTELRHWSDMLASPRRPIAQWHTLKDPE 464
            ..|..||||:||||:|||||||||:|:.|:
Human   349 AGGAGLRHWADMLANPRRPIAQWHSLRPPD 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467 6/25 (24%)
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 69/123 (56%)
C2B_Synaptotagmin-1 326..461 CDD:176047 95/134 (71%)
SYT5NP_003171.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
C2A_Synaptotagmin-1-5-6-9-10 109..231 CDD:176031 69/122 (57%)
C2 240..374 CDD:387358 95/133 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3696
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48342
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10024
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.