DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Doc2a

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_075226.1 Gene:Doc2a / 65031 RGDID:620518 Length:403 Species:Rattus norvegicus


Alignment Length:332 Identity:116/332 - (34%)
Similarity:157/332 - (47%) Gaps:42/332 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALD 223
            |||:     ..||      :..|.|..|......||.|.|.|.||..|..|...:::|:.|..:|
  Rat    70 LLGA-----TTPD------DGAEVDSYDSDDTTALGTLEFDLLYDQASCMLHCRILRAKGLKPMD 123

  Fly   224 MGGTSDPYVKVYLLPD--KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRF 286
            ..|.:|||||::|||.  |..|.:||..|.||:||:||..|:..:...|..:|.|..::.|.|:.
  Rat   124 FNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDDITHKVLRISVCDEDKL 188

  Fly   287 SKHDQIGEVKVPLCTIDLAQ------TIEEWRDLVS---------------------VEGEGGQE 324
            |.::.|||::|||..:..:|      .:|....|.|                     .:|.|..|
  Rat   189 SHNEFIGEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISCYLKELEQAEQGPGLLE 253

  Fly   325 KLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLN 389
            :.|.|..||.|......|.|.|:...:|..|||.|.||||||..:..:..:..|.||.:||.|||
  Rat   254 ERGRILLSLSYSSRRHGLLVGIVRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLN 318

  Fly   390 PYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEP-IGRCILGCMGTGTELRHWSDMLASPRRP 453
            |.:||.|.:|:....:....|.|||.||| ||.|.. ||...||....|...:||.|.|..|...
  Rat   319 PEFNEEFFYEMELSTLATKTLEVTVWDYD-IGKSNDFIGGVSLGPGARGEAQKHWRDCLHQPDTA 382

  Fly   454 IAQWHTL 460
            :.:||||
  Rat   383 VERWHTL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 48/131 (37%)
C2B_Synaptotagmin-1 326..461 CDD:176047 56/136 (41%)
Doc2aNP_075226.1 Interaction with UNC13D and DYNLT1. /evidence=ECO:0000250 1..92 8/32 (25%)
C2A_Rabphilin_Doc2 93..216 CDD:176000 46/122 (38%)
Interaction with UNC13D. /evidence=ECO:0000250 218..403 61/173 (35%)
C2B_Rabphilin_Doc2 257..389 CDD:176030 53/132 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.