DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Syt7

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_006231127.1 Gene:Syt7 / 59267 RGDID:62013 Length:687 Species:Rattus norvegicus


Alignment Length:292 Identity:134/292 - (45%)
Similarity:198/292 - (67%) Gaps:4/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVY 235
            :|..|:..:||.:..:..|.:.|||:.|.:.|:|..::|.|.|::|:||||.|..|||||:||:|
  Rat   398 EMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIY 462

  Fly   236 LLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLC 300
            ||||||.|.||||.||.|:|.:||||.|:..||...:.:.|...:.|:||||::|.||||.:||.
  Rat   463 LLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLN 527

  Fly   301 TIDLAQTIEEWRDLVSV-EGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPY 364
            .:||.|....|:||... :|.|.:   |::..||.|.|:|..:.|.|::|:|||.||:||.||||
  Rat   528 KVDLTQMQTFWKDLKPCSDGSGSR---GELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPY 589

  Fly   365 VKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRC 429
            ||:.:|...||::||||..||..|||.:||||:|::|.|::::..:::||:|.|::..::.||:.
  Rat   590 VKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKI 654

  Fly   430 ILGCMGTGTELRHWSDMLASPRRPIAQWHTLK 461
            .|.......|::||.||:|.||:|:||||.||
  Rat   655 YLSWKSGPGEVKHWKDMIARPRQPVAQWHQLK 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 64/123 (52%)
C2B_Synaptotagmin-1 326..461 CDD:176047 61/134 (46%)
Syt7XP_006231127.1 C2A_Synaptotagmin-7 419..543 CDD:176032 64/123 (52%)
C2B_Synaptotagmin-7 551..686 CDD:176050 61/137 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.