DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and SYT13

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_065877.1 Gene:SYT13 / 57586 HGNCID:14962 Length:426 Species:Homo sapiens


Alignment Length:321 Identity:94/321 - (29%)
Similarity:148/321 - (46%) Gaps:38/321 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAYKEKVQPDMEELTENA--------EEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEE 218
            |..|.:|..::..|.:|.        |..:.|...|..:..:|::.|:||.....|.||.::|  
Human   120 SRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRLEA-- 182

  Fly   219 LPALDMGGTSDPYVKVYLLPD----------KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMN 273
             ...:..|..|.||:..:...          ||::..|......:.|:..|     .||.|    
Human   183 -VTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEE-----ELPTA---- 237

  Fly   274 KTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDL--VSVEGEGGQEKLGDICFSLRYV 336
             ||...:...||||:|...||:::.|....:.....:|.:|  .:.|...|   .|::..|:.|:
Human   238 -TLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAG---AGEVLLSISYL 298

  Fly   337 PTAGKLTVVILEAKNLKKMDVGGL--SDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFE 399
            |.|.:|.||:::||||.......|  .|..||:.:....::||||:|...|..:||.:||...||
Human   299 PAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFE 363

  Fly   400 VPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 460
            :|.:.:|...:.:.|:..|..|.|..:|.|.||...:|:|..||.:||.:|||.||.||.|
Human   364 LPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAMWHQL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 32/135 (24%)
C2B_Synaptotagmin-1 326..461 CDD:176047 52/137 (38%)
SYT13NP_065877.1 C2A_Synaptotagmin-13 160..277 CDD:176059 31/129 (24%)
C2B_Synaptotagmin-13 288..425 CDD:176052 52/137 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.