DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and doc2a

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_003198125.1 Gene:doc2a / 558815 ZFINID:ZDB-GENE-090706-1 Length:422 Species:Danio rerio


Alignment Length:323 Identity:109/323 - (33%)
Similarity:161/323 - (49%) Gaps:46/323 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 DKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPD--KKKKFETKV 248
            |......||.|.|:|.|:..::||..|:|:|:.|..:|..|.:|||||::|||.  |..|.:||.
Zfish   101 DSDDSTALGTLEFELRYEKATSSLNCTIIRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKT 165

  Fly   249 HRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQT------ 307
            .|.:|:||:|||.|:..:...|...|||..::.|.|:.:.::.|||.:|.|..:...||      
Zfish   166 VRNSLNPVWNETLTYVGITEEDMHRKTLRLSVCDEDKLTHNEFIGESRVALRRVKPDQTKRFYTC 230

  Fly   308 -----------------------IEEWRDLVSVEGEGGQEKLGDICFSLRYVP---------TAG 340
                                   :.||.:    |.....|:.|.:..||:::|         ..|
Zfish   231 LEHPPPLPSPTAMGAALRGISCYLREWEN----EQMTSLEERGRLLLSLQFLPPPAEGEGESRRG 291

  Fly   341 KLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQI 405
            .|.|.:|...:|..|||.|.|||||||.:..:.|:..|.|||:.|.||||.:||.|.:|:...::
Zfish   292 GLCVGVLRCAHLAAMDVNGFSDPYVKIYLKPDVKKKSKHKTSVIKKTLNPEFNEEFFYEISLSEL 356

  Fly   406 QKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKD--PEET 466
            ....|.|||.|||...:::.||...|.|...|..||||.|.|.:..:.:.:||.|.:  |:.|
Zfish   357 VHKTLEVTVWDYDLGRSNDFIGGVCLSCHVQGDALRHWMDCLRNKGQRVERWHILANELPQTT 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 49/154 (32%)
C2B_Synaptotagmin-1 326..461 CDD:176047 54/143 (38%)
doc2aXP_003198125.1 C2A_Rabphilin_Doc2 108..231 CDD:176000 47/122 (39%)
C2B_Rabphilin_Doc2 270..411 CDD:176030 53/140 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.