DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Syt7

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_030106854.1 Gene:Syt7 / 54525 MGIID:1859545 Length:719 Species:Mus musculus


Alignment Length:292 Identity:134/292 - (45%)
Similarity:198/292 - (67%) Gaps:4/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVY 235
            :|..|:..:||.:..:..|.:.|||:.|.:.|:|..::|.|.|::|:||||.|..|||||:||:|
Mouse   430 EMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIY 494

  Fly   236 LLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLC 300
            ||||||.|.||||.||.|:|.:||||.|:..||...:.:.|...:.|:||||::|.||||.:||.
Mouse   495 LLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLN 559

  Fly   301 TIDLAQTIEEWRDLVSV-EGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPY 364
            .:||.|....|:||... :|.|.:   |::..||.|.|:|..:.|.|::|:|||.||:||.||||
Mouse   560 KVDLTQMQTFWKDLKPCSDGSGSR---GELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPY 621

  Fly   365 VKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRC 429
            ||:.:|...||::||||..||..|||.:||||:|::|.|::::..:::||:|.|::..::.||:.
Mouse   622 VKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSRNDVIGKI 686

  Fly   430 ILGCMGTGTELRHWSDMLASPRRPIAQWHTLK 461
            .|.......|::||.||:|.||:|:||||.||
Mouse   687 YLSWKSGPGEVKHWKDMIARPRQPVAQWHQLK 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 64/123 (52%)
C2B_Synaptotagmin-1 326..461 CDD:176047 61/134 (46%)
Syt7XP_030106854.1 PHA03307 138..>343 CDD:223039
C2A_Synaptotagmin-7 451..575 CDD:176032 64/123 (52%)
C2B_Synaptotagmin-7 583..718 CDD:176050 61/137 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.