DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Syt5

DIOPT Version :10

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001347350.1 Gene:Syt5 / 53420 MGIID:1926368 Length:386 Species:Mus musculus


Alignment Length:45 Identity:13/45 - (28%)
Similarity:18/45 - (40%) Gaps:4/45 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VTLFAFLVYPSLG--LAMMPDVDERTTVA--DRNSIVRCEFRFPD 106
            |.::...|:..||  :.:..||.|.....  ....|.||..|.||
Mouse   751 VMIYNLSVHQQLGKMVVVSDDVHEYAVALKDTEEKIARCPSRRPD 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Syt1_2_N 62..161 CDD:425364 13/45 (29%)
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031
C2B_Synaptotagmin-1 326..461 CDD:176047
Syt5NP_001347350.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Syt1_2_N 6..76 CDD:425364
C2 108..230 CDD:472691
C2 240..374 CDD:472691
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.