DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and SYT17

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_011544168.1 Gene:SYT17 / 51760 HGNCID:24119 Length:481 Species:Homo sapiens


Alignment Length:349 Identity:131/349 - (37%)
Similarity:204/349 - (58%) Gaps:35/349 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VDMKSVQL-LGSAYKEKVQPD------------------MEELTENAEEGD---EEDKQSEQKLG 194
            :|:|.::. :.||.||.:||.                  :..|..|:::.|   :|:..|:.:||
Human   129 IDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPHLYSLDSNSDDVDSLTDEEILSKYQLG 193

  Fly   195 RLNFKLEYDFNSNSLAVTVIQAEELP--------ALDMGGTSDPYVKVYLLPDKKKKFETKVHRK 251
            .|:|..:||...|.|.|.||:|.:||        ..|| ..|:||||:.||||:|...:|.|.||
Human   194 MLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDM-AHSNPYVKICLLPDQKNSKQTGVKRK 257

  Fly   252 TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 316
            |..|||.|.:||: :|:.:|..:||:..:.|||:||:|..||:|.||||.:||.:....|:.|  
Human   258 TQKPVFEERYTFE-IPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKAL-- 319

  Fly   317 VEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKT 381
            :.....:.:||::..||.|:|:||:|.|.::.||.|.:.||...|||:|||.::...|.:|.|||
Human   320 IPSSQNEVELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKT 384

  Fly   382 SIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTG-TELRHWSD 445
            |..:.|::|:|||||||:||.|:::...||.||..::...:::.|||.::|...:| :|..||..
Human   385 SFLRGTIDPFYNESFSFKVPQEELENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRR 449

  Fly   446 MLASPRRPIAQWHTLKDPEETDEI 469
            ||.:.|..:.|||:|:...|.|.:
Human   450 MLNTHRTAVEQWHSLRSRAECDRV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 58/131 (44%)
C2B_Synaptotagmin-1 326..461 CDD:176047 57/135 (42%)
SYT17XP_011544168.1 C2A_Synaptotagmin-15-17 193..321 CDD:176036 57/131 (44%)
C2B_Synaptotagmin-17 330..464 CDD:176055 56/133 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.