DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and sytl1

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001006773.1 Gene:sytl1 / 448459 XenbaseID:XB-GENE-972182 Length:518 Species:Xenopus tropicalis


Alignment Length:368 Identity:97/368 - (26%)
Similarity:164/368 - (44%) Gaps:62/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 TKDGKGK-KGVDMKSV-----------QLLGSAYKEKVQPDMEELTENAEEG------DEEDKQS 189
            |.|||.. :.:::..|           ::|.........|.:..||.|:..|      ...|.:|
 Frog   153 TTDGKNSMEDINLSPVNGTITSGDTNGEILEGKENLNDSPPVPRLTNNSISGSMISLFSTGDMRS 217

  Fly   190 EQKLGRLNFKLEYDFNSNSLAVTVIQAEEL-PALDMGGTSDPYVKVYLLPDK--KKKFETKVHRK 251
            ....|.:.|.|:||.:...|.|.:||..:| ||  ...||:||:|.||||||  :.|.::||.:|
 Frog   218 VDVQGCVQFSLQYDPSKKELNVLIIQCRDLTPA--QRKTSNPYIKCYLLPDKTVQGKRKSKVKKK 280

  Fly   252 TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVS 316
            ||.|.||||..:| :..::..::.|..:::......::..:|||:|.|.:.|.::|...|.:|  
 Frog   281 TLEPFFNETLKYK-VERSELQSRVLNLSVWHRGSLGRNIFLGEVEVDLVSWDWSKTQPSWFNL-- 342

  Fly   317 VEGEGGQEKL----------GDICFSLRYV---------PTAGKLTVVILEAKNLKKMDVGGLSD 362
                  |.:.          |.|..:|:||         |..|:|.|.|.||:.|.....|.:| 
 Frog   343 ------QPRTPLSPDFLCSRGRISVALKYVPQGAEGLGLPPTGELHVWIKEARQLVPHKAGNVS- 400

  Fly   363 PYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFE-VPFEQIQKICLVVTVVDYDRIGTSEPI 426
            .:||..::.:......:.|.:...:|:|.:|.:..:: ...|.:::.|:..|:.|..:|| |..:
 Frog   401 TFVKCFVLPDSVPSNFQNTRVIPHSLHPMFNHTMVYDGFSGEDLKEACVECTIWDQGKIG-SRSL 464

  Fly   427 GRCILGCMGTGTELR---HWSDMLASPRRPIAQWHT-LKDPEE 465
            |...|. .|.|:...   .|.|.....:   |.|.: :.:|.|
 Frog   465 GGIRLS-TGKGSSYETSVSWMDSTVEEK---AFWESVINNPGE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 45/126 (36%)
C2B_Synaptotagmin-1 326..461 CDD:176047 36/158 (23%)
sytl1NP_001006773.1 PHD_SF 20..>66 CDD:419867
C2 221..343 CDD:417471 45/132 (34%)
C2B_SLP_1-2-3-4 356..512 CDD:175987 38/154 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.