DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Syt14

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster


Alignment Length:340 Identity:90/340 - (26%)
Similarity:155/340 - (45%) Gaps:51/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DMKSVQ----LLGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTV 213
            |::|::    |:|...||..          .:.|..|          |...|.||.....:.|.|
  Fly   267 DLRSIKSDDLLVGVDQKEPA----------VQRGPIE----------LELSLLYDAPMRKMTVHV 311

  Fly   214 IQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVF 278
            :||:.||.|..|.|:...|::.:||.||:|.:||: |...:|.:.|:|....:...|..|..|..
  Fly   312 MQAKNLPPLGSGQTTHTQVRMLMLPSKKQKLKTKI-RSGENPQYMESFLLHRVNPEDVNNMGLRV 375

  Fly   279 AIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEW---------------RDLVSV---EGEGGQEK 325
            .::..:|..|...|||..|...|:||......|               .||:|:   |..|....
  Fly   376 RLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSS 440

  Fly   326 L-----GDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQN-GKRLKKKKTSIK 384
            :     .::...|.|....|:|:|.|::....:.:.:....|.|||:.::.: |:.:.:.||||:
  Fly   441 MQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIR 505

  Fly   385 KCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGT-ELRHWSDMLA 448
            :...||.:.|:|:|:|...|:..:.|:::|.....:..:|.:|...||...:|: |:.||:|:..
  Fly   506 RGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCE 570

  Fly   449 SPR-RPIAQWHTLKD 462
            .|: ..:|:||.|.|
  Fly   571 MPKGEMLARWHVLVD 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 40/138 (29%)
C2B_Synaptotagmin-1 326..461 CDD:176047 37/142 (26%)
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 39/132 (30%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 37/137 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.