DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and DH11.5

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001254131.1 Gene:DH11.5 / 3565199 WormBaseID:WBGene00008438 Length:825 Species:Caenorhabditis elegans


Alignment Length:386 Identity:83/386 - (21%)
Similarity:139/386 - (36%) Gaps:138/386 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 VQPDMEELTEN--------AEEGDEEDKQSEQKLGRLNFKLEYDFNSNS---LAVTVIQAEELPA 221
            |:.::.|..|:        .|||             :||..::.|...|   :....:...::||
 Worm   482 VEQEISEYLEHCRDASVNITEEG-------------MNFIAKHFFEYQSFMNIPHKAVHLHKVPA 533

  Fly   222 LDMGGTSDPYV----KVYLLPDKKKKF----ETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVF 278
            ...|  :||.:    |..|...|.:..    ..:|||   .|..|.|                  
 Worm   534 SQAG--TDPSMGWAPKNMLKAGKHQPAPGARANRVHR---DPRPNGT------------------ 575

  Fly   279 AIFDFDRFSKH------DQIGEV---KVPLCTIDL-----------AQTIEE--WRD-LVSVEGE 320
               .:.|..||      |:.||:   || .|..|.           |:|..|  :.| :::.|.|
 Worm   576 ---KYGRAGKHEHREWGDRHGELRDEKV-ACHKDAWTKFLANDDQGARTAFECDFEDRVLATEEE 636

  Fly   321 GGQEKL------------------------GDIC---FSLRYVPTAGKLTVVILEAKNLKKMDVG 358
            ..||||                        ||:|   ..|.|.||...:|..:.:||.|...:. 
 Worm   637 TLQEKLCRTSPEAMNLNALYAAANKAVSCGGDVCELLTILTYAPTVQFVTTTVKKAKALPYNNA- 700

  Fly   359 GLSDPYVKIAIMQNGKRLKKKKTSIKKCTL---------------------NP---YYNESFSFE 399
                |:.:|.:.:..:.:::|:|::....:                     ||   .::|||.|.
 Worm   701 ----PFARIMLFEGRRLMEQKQTTVNPSLVHKSSVDGSKPSSSSASTSSNDNPSDVSFSESFLFH 761

  Fly   400 VPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTL 460
            ||..::.:..:|:.:.|:|..|..:.||.|::|.:..||...||..|:.....|:..||.:
 Worm   762 VPPTKLDRSHIVIELYDHDDEGGLQKIGHCVIGRLVDGTGNAHWIQMVRQHGLPVCMWHKI 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 32/157 (20%)
C2B_Synaptotagmin-1 326..461 CDD:176047 40/186 (22%)
DH11.5NP_001254131.1 C2B_Synaptotagmin 671..822 CDD:175975 36/155 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.