DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and btsz

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001247109.1 Gene:btsz / 3346167 FlyBaseID:FBgn0266756 Length:3734 Species:Drosophila melanogaster


Alignment Length:319 Identity:98/319 - (30%)
Similarity:153/319 - (47%) Gaps:66/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GRLNFKLEYDFNSNSLAVTVIQAEELPALD-MGGTSDPYVKVYLLPDKKK--KFETKVHRKTLSP 255
            |::.|.::|::..::|.|.|::.::|.|:| ....|||||||||||||.|  |.:|||.:.||:|
  Fly  3398 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNP 3462

  Fly   256 VFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPL--CTIDLAQTIEEWRDLVSVE 318
            :|:||..|.: |.:...::||...::..|.|.::|.:|||.|.|  ...|..|:  :|. |:...
  Fly  3463 IFDETMRFHT-PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQS--QWY-LLQER 3523

  Fly   319 GEGGQEKL---GDICFSLRYVP----------------------------------------TAG 340
            .|...|..   |||...|:|:|                                        ..|
  Fly  3524 SEPFDEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGG 3588

  Fly   341 KLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFE-VPFEQ 404
            :|.|::.|||:|..:...|..|.:.|..::.:..|..|:||.:.|.||:|.:|.:|.:| |..|:
  Fly  3589 QLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEE 3653

  Fly   405 IQKICLVVTVVDYDR-------------IGTSEPIGRCILGCMGTGTELRHWSDMLASP 450
            :.:..|.:||.|:||             :||....||.:.....||.||..|.:||..|
  Fly  3654 LSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRP 3712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 49/126 (39%)
C2B_Synaptotagmin-1 326..461 CDD:176047 47/182 (26%)
btszNP_001247109.1 FYVE_Slp3_4_5 26..73 CDD:277286
SOBP <300..476 CDD:291927
C2A_SLP 3398..3520 CDD:176056 48/125 (38%)
C2B_SLP_1-2-3-4 3534..3723 CDD:175987 47/179 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1065
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.