DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Pla2g4e

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_808513.2 Gene:Pla2g4e / 329502 MGIID:1919144 Length:875 Species:Mus musculus


Alignment Length:261 Identity:52/261 - (19%)
Similarity:96/261 - (36%) Gaps:56/261 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMN 273
            |.|.:|..:.:...|:...:|.:|.::|....:||.:|:.....|.|.::|:|||:   ....:.
Mouse    83 LTVRIIGMKNVRQADILSQTDCFVTLWLPTASQKKLKTRTISNCLHPEWDESFTFQ---IQTQVK 144

  Fly   274 KTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVE----GEGGQEKLGDICFSLR 334
            ..|..::.|.|..:::|.:..|...|..:.|       |:...|:    .||.:|...:......
Mouse   145 NVLELSVCDEDTLTQNDHLLTVLYDLSKLCL-------RNKTHVKFPLNPEGM
EELEVEFLLEEN 202

  Fly   335 YVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCT------------ 387
            :..:...:|..:|.::.:..::|...|         :..::.||.|..:...|            
Mouse   203 FSSSETLITNGVLVSRQVSCLEVHAES---------RRPRKRKKNKDLLVMVTDSFENTQRVPPC 258

  Fly   388 LNPYYNESFSFEVP-FEQIQKICLVVTVVDYDRIGTSEPIGRC--ILGCMGTGTELRHWSDMLAS 449
            ..|.|..|..|..| :.|.|             :....|...|  .|.|.||     |.:|.:..
Mouse   259 QEPCYPNSACFHYPKYSQPQ-------------LYAEAPKSHCNFRLCCCGT-----HRNDPVCQ 305

  Fly   450 P 450
            |
Mouse   306 P 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 24/106 (23%)
C2B_Synaptotagmin-1 326..461 CDD:176047 24/140 (17%)
Pla2g4eNP_808513.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..70
C2_cPLA2 82..190 CDD:176001 26/116 (22%)
PLAc 324..811 CDD:214474
cPLA2_Grp-IVB-IVD-IVE-IVF 328..870 CDD:132840
Required for localization at membrane structures. /evidence=ECO:0000269|PubMed:24413173 865..875
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.