DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Pla2g4b

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_038960869.1 Gene:Pla2g4b / 311341 RGDID:1308658 Length:836 Species:Rattus norvegicus


Alignment Length:205 Identity:46/205 - (22%)
Similarity:87/205 - (42%) Gaps:26/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMN 273
            |.|.|:||..||:.|:..:||.||.:.|........:|:..:.:.:||:|:.|.|:   ....:.
  Rat    65 LTVRVLQASGLPSKDLVTSSDCYVTLNLPTASSGTLQTRTVKNSRNPVWNQNFHFR---IHRQLK 126

  Fly   274 KTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPT 338
            ..:...:||.|..:|.|.:..|...:.|:.:....:.:.  :|.:.:|..|    :.|.|:.:..
  Rat   127 NVMELKVFDQDLMTKDDPVLSVLFDVGTLQVGTQRQSFS--LSAQEDGRLE----VEFRLQT
LTD 185

  Fly   339 AGKLTVV--ILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLN-----PYYNESF 396
            ..:..:.  ||.|:.|..:        :|::....:.||.::|...:......     |....||
  Rat   186 CEEQLISNGILVAQELSCL--------HVELKRTGDPKRSERKVQLVVAAACEGPQEAPVGTGSF 242

  Fly   397 SFEVP--FEQ 404
            .|..|  :||
  Rat   243 RFHYPACWEQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 26/106 (25%)
C2B_Synaptotagmin-1 326..461 CDD:176047 17/88 (19%)
Pla2g4bXP_038960869.1 C2_cPLA2 64..182 CDD:176001 31/125 (25%)
cPLA2_C2 203..293 CDD:408472 11/58 (19%)
Patatin_and_cPLA2 295..824 CDD:416256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.