Sequence 1: | NP_523460.2 | Gene: | Syt1 / 33473 | FlyBaseID: | FBgn0004242 | Length: | 474 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038960869.1 | Gene: | Pla2g4b / 311341 | RGDID: | 1308658 | Length: | 836 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 46/205 - (22%) |
---|---|---|---|
Similarity: | 87/205 - (42%) | Gaps: | 26/205 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMN 273
Fly 274 KTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPT 338
Fly 339 AGKLTVV--ILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLN-----PYYNESF 396
Fly 397 SFEVP--FEQ 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Syt1 | NP_523460.2 | Podoplanin | 5..136 | CDD:283467 | |
C2A_Synaptotagmin-1-5-6-9-10 | 192..316 | CDD:176031 | 26/106 (25%) | ||
C2B_Synaptotagmin-1 | 326..461 | CDD:176047 | 17/88 (19%) | ||
Pla2g4b | XP_038960869.1 | C2_cPLA2 | 64..182 | CDD:176001 | 31/125 (25%) |
cPLA2_C2 | 203..293 | CDD:408472 | 11/58 (19%) | ||
Patatin_and_cPLA2 | 295..824 | CDD:416256 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1028 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |