DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Doc2g

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_006230797.1 Gene:Doc2g / 293654 RGDID:1307473 Length:389 Species:Rattus norvegicus


Alignment Length:328 Identity:104/328 - (31%)
Similarity:161/328 - (49%) Gaps:48/328 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEEL--PALDMGGTSD 229
            ::||:.|      .|||.:|..:   ||.|.|.|.:|.::::|..|..:|:.|  ||.   |:.|
  Rat    67 QLQPNPE------AEGDSDDSTA---LGTLEFTLLFDVDNSTLHCTAHRAKGLKPPAT---GSVD 119

  Fly   230 PYVKVYLLPDKKK----KFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHD 290
            .|||..|||...|    :..|:..|.|..||:.||.|:......||..|||...:.:..|..:..
  Rat   120 TYVKANLLPGASKVRASQLRTRTVRGTREPVWEETLTYHGFTCQDAGRKTLRLCVCEDSRLRRRR 184

  Fly   291 Q---IGEVKVPL-------------C-----------TIDLAQTIEEWRDLVSVEGEGGQEKLGD 328
            :   :||::|||             |           ::|.|:.:..:.: ..||.|..:|:.|.
  Rat   185 RAPPLGELRVPLRKLVPNRARSFDICLEKRRLTKRPKSLDTARGMSLYEE-EEVEAEVFREERGR 248

  Fly   329 ICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYN 393
            |..||.|....|.|.|.:|...:|..||..|.|||:|::.:..:..:..|.|||:::.||||.:|
  Rat   249 ILLSLCYSSERGGLLVGVLRCAHLAPMDANGYSDPFVRLFLHPSSGKKSKYKTSVRRKTLNPEFN 313

  Fly   394 ESFSFEVPFEQIQKICLVVTVVDYDRIGTSEP-IGRCILGCMGTGTELRHWSDMLASPRRPIAQW 457
            |.|.:....|::.:..|:|:|.||| :||::. ||...|....:|..||||.:.|:...|.:..|
  Rat   314 EEFFYAGLREELAQKALLVSVWDYD-LGTADDFIGGVQLSGRSSGDRLRHWCECLSHCDRRLELW 377

  Fly   458 HTL 460
            |.|
  Rat   378 HLL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 43/156 (28%)
C2B_Synaptotagmin-1 326..461 CDD:176047 50/136 (37%)
Doc2gXP_006230797.1 C2A_Rabphilin_Doc2 84..211 CDD:176000 40/129 (31%)
C2 248..380 CDD:301316 48/132 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.