DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Syt16

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001351210.1 Gene:Syt16 / 238266 MGIID:2673872 Length:654 Species:Mus musculus


Alignment Length:323 Identity:83/323 - (25%)
Similarity:141/323 - (43%) Gaps:56/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DEEDKQSEQ----------KLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLL 237
            :|:|..|.|          |.|.|:...||...:..|.||:::|:.||..|..|.:...|.:.||
Mouse   340 EEQDGTSLQVPHRLLEPISKCGDLDVIFEYRAVTQKLTVTIVRAQGLPDKDRSGVNSWQVHIVLL 404

  Fly   238 PDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQI---------- 292
            |.||::.:|.:.|.. :|||.|..||..|...|..:..:.|.::...:.::...:          
Mouse   405 PSKKQRGKTNIQRGP-NPVFKEKVTFTKLEPRDVASCAVRFRLYAARKMTRERMMGEKLFCLSHL 468

  Fly   293 ---GEVKVPLCTIDLAQTIEEWRDLVSVE--------------------GEGGQEKLGDICFSLR 334
               ||:||.|       .:|...:|.|.|                    ..||   :.::...|.
Mouse   469 HPEGEMKVTL-------VLEPRSNLSSGESPLSPSVVSHSDSASSTQSLSHGG---VPELLVGLS 523

  Fly   335 YVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQ-NGKRLKKKKTSIKKCTLNPYYNESFSF 398
            |..|.|:|:|.:::..:.:.:......|.|.|:.::. .|:.:.:.||||::...||.|.|:|.|
Mouse   524 YNATTGRLSVEMIKGSHFRNLAANRAPDTYGKLFLLNCVGQEMSRCKTSIRRGQPNPVYKETFVF 588

  Fly   399 EVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTG-TELRHWSDMLASPRRPIAQWHTL 460
            :|...|:..:.|::::.....:...|.||...||...:| .|..||.:|..|..:...:||||
Mouse   589 QVALFQLSDVTLMISIYSRRTMKRKEMIGWVALGQNSSGEEEQEHWEEMKESKGQQTCRWHTL 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 37/136 (27%)
C2B_Synaptotagmin-1 326..461 CDD:176047 38/137 (28%)
Syt16NP_001351210.1 C2A_Synaptotagmin-14_16 359..482 CDD:176035 35/130 (27%)
C2B_Synaptotagmin-14_16 515..652 CDD:176053 38/137 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.