DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and RPH3A

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001137326.1 Gene:RPH3A / 22895 HGNCID:17056 Length:694 Species:Homo sapiens


Alignment Length:326 Identity:110/326 - (33%)
Similarity:163/326 - (50%) Gaps:30/326 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGG 226
            :|.::...|:.||     ||.:..|......||.|.|.|.||.:::||..|:|:|:.|..:|..|
Human   367 AAARQPPPPEEEE-----EEANSYDSDEATTLGALEFSLLYDQDNSSLQCTIIKAKGLKPMDSNG 426

  Fly   227 TSDPYVKVYLLP--DKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKH 289
            .:|||||::|||  .|..|..||..|.|.:|::|||..:..:...|...|||..::.|.|:|..:
Human   427 LADPYVKLHLLPGASKSNKLRTKTLRNTRNPIWNETLVYHGITDEDMQRKTLRISVCDEDKFGHN 491

  Fly   290 DQIGEVKVPL-------------C-----TIDLAQTIEEWRDLV-----SVEGEGGQEKLGDICF 331
            :.|||.:..|             |     .:..|.|....|.:.     .||..|..|:.|.|..
Human   492 EFIGETRFSLKKLKPNQRKNFNICLERVIPMKRAGTTGSARGMALYEEEQVERVGDIEERGKILV 556

  Fly   332 SLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESF 396
            ||.|....|.|.|.|:...:|..||..|.|||:||:.:..:..:..|.||.|||.||||.:||.|
Human   557 SLMYSTQQGGLIVGIIRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEF 621

  Fly   397 SFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLK 461
            .:::....:.|..|.::|.|||...:::.||.|.||....|..|:||.:.|.:..:.|.:||.|:
Human   622 FYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAKGERLKHWYECLKNKDKKIERWHQLQ 686

  Fly   462 D 462
            :
Human   687 N 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 48/148 (32%)
C2B_Synaptotagmin-1 326..461 CDD:176047 50/134 (37%)
RPH3ANP_001137326.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
FYVE_RP3A 92..171 CDD:277301
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..388 7/25 (28%)
C2A_Rabphilin_Doc2 393..516 CDD:176000 44/122 (36%)
C2B_Rabphilin_Doc2 553..685 CDD:176030 49/131 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X85
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.