DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Y75B7AL.2

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_503404.3 Gene:Y75B7AL.2 / 190697 WormBaseID:WBGene00022285 Length:524 Species:Caenorhabditis elegans


Alignment Length:221 Identity:49/221 - (22%)
Similarity:80/221 - (36%) Gaps:63/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AADLESVDQK-------LE-ETHHSKFREVDR-------QEQEVLA---------EKAAEAASQR 64
            |.|||....|       :| ||....|..|:|       .|.|::.         |...:.||.|
 Worm   272 AMDLEIQKAKAVVFEVLIELETESKVFATVERTAIGEMQSEYEIVLCSSHNVPFDEDFHKTASSR 336

  Fly    65 IAQVESTTRSATTEAQESTTTAVPVIKKIEHVGEVVTEVIAERTGLPTWGVVAIIILVFLVVFGI 129
            |  :|..|.:..|...::...|.....||:...:.:::|:|   .|..:.::|  .||.:..:..
 Worm   337 I--LERLTVTKKTNRLQTVFKATIFSSKIDRTIQTLSKVVA---CLIYFSILA--ALVGMYAYQN 394

  Fly   130 IFFCVRR------FLKKRRTKDGKGKKGVDMKSVQLLGSAYKEKVQPDME------------ELT 176
            :...|.|      .:|.||..|   ...::|:...       |.:|.|..            |..
 Worm   395 VELRVSRQNPFTPIVKYRRQAD---DVAIEMEEAM-------EDIQSDSTLEGDTQMLISSVETP 449

  Fly   177 ENAEEGDEEDKQSEQKLGRLNFKLEY 202
            |.|...|.||.::...    ||:|::
 Worm   450 EIANSEDIEDLRNVNP----NFELDH 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467 31/135 (23%)
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 3/11 (27%)
C2B_Synaptotagmin-1 326..461 CDD:176047
Y75B7AL.2NP_503404.3 Amnionless 25..>268 CDD:291494
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.