DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and Y48G8AR.2

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_490838.3 Gene:Y48G8AR.2 / 171702 WormBaseID:WBGene00021693 Length:339 Species:Caenorhabditis elegans


Alignment Length:114 Identity:25/114 - (21%)
Similarity:42/114 - (36%) Gaps:36/114 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 KVPLCTI-----DLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKM 355
            |..|||:     :|:....||     |:|....||            |:.:|..|:..::....:
 Worm   139 KYSLCTVCYSERELSAAKNEW
-----VQGSDEAEK------------TSEQLLNVMKSSEKRNSV 186

  Fly   356 DVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQ 404
            .:.. :.|.||      ||...|:..::      |....|: ..||.|:
 Worm   187 QIPA-TPPAVK------GKAPYKRNLTL------PAIQTSY-LSVPDEE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 7/24 (29%)
C2B_Synaptotagmin-1 326..461 CDD:176047 14/79 (18%)
Y48G8AR.2NP_490838.3 PHD_SF 15..159 CDD:389947 5/19 (26%)
FYVE_Slp3_4_5 95..148 CDD:277286 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.