DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and SYT6

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001353153.1 Gene:SYT6 / 148281 HGNCID:18638 Length:528 Species:Homo sapiens


Alignment Length:310 Identity:137/310 - (44%)
Similarity:214/310 - (69%) Gaps:13/310 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPY 231
            :::|::.:  :.:.:|::...::.:..|::||.|.||:.:.:|.|.:::|.:|||.|..|:||||
Human   206 RIKPELYK--QKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPY 268

  Fly   232 VKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVK 296
            ||:|||||:|.|.:|:||||||:|.|:|.|.| .:||.:..::.|..::|||||||:||.||||.
Human   269 VKIYLLPDRKCKLQTRVHRKTLNPTFDENFHF-PVPYEELADRKLHLSVFDFDRFSRHDMIGEVI 332

  Fly   297 VP--LCTIDLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGG 359
            :.  ....||::....|:|:.....|  ...||:|.|||.|:||||:||:.:::.:|||.||:.|
Human   333 LDNLFEASDLSRETSIWKDIQYATSE--SVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITG 395

  Fly   360 LSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSE 424
            .||||||::::.:|:|||||||:|||.||||.|||:..|::|.|.:.::.|:::|:||||:|.:|
Human   396 YSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNE 460

  Fly   425 PIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETDEILKNMK 474
            .||.|.:|....|....||::|||.||:|||.||:|.      |:.|:.|
Human   461 IIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLV------EVKKSFK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 59/125 (47%)
C2B_Synaptotagmin-1 326..461 CDD:176047 71/134 (53%)
SYT6NP_001353153.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 12..38
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178
C2A_Synaptotagmin-1-5-6-9-10 230..354 CDD:176031 59/124 (48%)
C2B_Synaptotagmin-3-5-6-9-10 363..496 CDD:176048 70/132 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.