DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and PLA2G4E

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001193599.1 Gene:PLA2G4E / 123745 HGNCID:24791 Length:868 Species:Homo sapiens


Alignment Length:221 Identity:47/221 - (21%)
Similarity:82/221 - (37%) Gaps:63/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMN 273
            |.|.||:.:.:...||...:|.:|.::|....:||..|:......:|.:||:|.|:   ....:.
Human    70 LTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNESFNFQ---IQSRVK 131

  Fly   274 KTLVFAIFDFDRFSKHDQI---------------GEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQ 323
            ..|..::.|.|..:..|.:               ..||.||                   ...|.
Human   132 NVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPL-------------------NPQGM 177

  Fly   324 EKLGDICFSLRYVPTAGKLTVV--ILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKC 386
            |:| ::.|.|...|:..:..|.  :|.::.:..::|...|             |.::|:..:|  
Human   178 EEL-EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQS-------------RRRRKREKMK-- 226

  Fly   387 TLNPYYNESFSFEVPFEQIQKI--CL 410
            .|....|||      ||..|::  ||
Human   227 DLLVMVNES------FENTQRVRPCL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 25/121 (21%)
C2B_Synaptotagmin-1 326..461 CDD:176047 20/89 (22%)
PLA2G4ENP_001193599.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
C2_cPLA2 69..177 CDD:176001 25/128 (20%)
cPLA2_Grp-IVB-IVD-IVE-IVF 320..863 CDD:132840
Required for localization at membrane structures. /evidence=ECO:0000269|PubMed:30517655 857..868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.