DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and LOC103909492

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_009293982.1 Gene:LOC103909492 / 103909492 -ID:- Length:185 Species:Danio rerio


Alignment Length:143 Identity:87/143 - (60%)
Similarity:109/143 - (76%) Gaps:2/143 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 NAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDPYVKVYLLPDKKK 242
            :|:|.|.|.|:: ||||:|.:.|:|:|..::|.|.||:||.|.|:||.|||||||||||||||||
Zfish    43 DAKEEDSESKEA-QKLGKLLYTLDYNFTDSTLIVGVIRAEGLAAMDMSGTSDPYVKVYLLPDKKK 106

  Fly   243 KFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQT 307
            |||||||||||.|.|||.|||| :|||:...||||..::|||||||||.||:|::.:..:|.:..
Zfish   107 KFETKVHRKTLEPTFNEHFTFK-VPYAELGGKTLVMTVYDFDRFSKHDAIGDVRLQMNKVDFSHL 170

  Fly   308 IEEWRDLVSVEGE 320
            .||||||...|.|
Zfish   171 TEEWRDLQKAEKE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 79/123 (64%)
C2B_Synaptotagmin-1 326..461 CDD:176047
LOC103909492XP_009293982.1 C2A_Synaptotagmin-1-5-6-9-10 56..179 CDD:176031 79/123 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.