DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and syt11

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_031747300.1 Gene:syt11 / 101731321 XenbaseID:XB-GENE-13579723 Length:430 Species:Xenopus tropicalis


Alignment Length:323 Identity:124/323 - (38%)
Similarity:198/323 - (61%) Gaps:8/323 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KGKKGVDMKSV--QL-LGSAYKEKVQPDMEELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNS 208
            ||..|:...:.  || :.|:|.::..|.....:..::........::..||.|:..::|:|...:
 Frog   108 KGPNGLATATCTDQLPVHSSYGDEFSPGQSLTSSGSKSSSPSSPDADTTLGTLSLSVDYNFPKKA 172

  Fly   209 LAVTVIQAEELPALD-MGGTSDPYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAM 272
            |.||:.:|..||.:| ....|||::|:.:|||||.:.:|:|.||||.|||:|||||..:||:...
 Frog   173 LVVTIQEAHGLPVMDEHSQCSDPFIKMTILPDKKHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQ 237

  Fly   273 NKTLVFAIFDFDRFSKHDQIGEVKVPLCTIDLAQ-TIEEWRDLVSVEGEGGQEKLGDICFSLRYV 336
            :..|.|.:..|||||:.|.||||.|||..:|.:. .::..||::....:....: |::..||.|.
 Frog   238 DLVLHFLVLSFDRFSRDDVIGEVLVPLAGVDPSTGKVQITRDIIKRNFQKCMSR-GELQVSLSYH 301

  Fly   337 PTAGKLTVVILEAKNLKKMDVGGLS-DPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEV 400
            |.|.::|||:|:||:|.:||:.||| :||||:.:..:.||:.||||.:|||||||.:||||.:::
 Frog   302 PVAQRMTVVVLKAKHLPRMDITGLSGNPYVKVNVYYSRKRIAKKKTHVKKCTLNPVFNESFIYDI 366

  Fly   401 PFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIAQWHTLKD 462
            |.:.:..|.:...|:|:||...::.|||.|||... |...:.||.::..:||:|:|:||.|.:
 Frog   367 PTDLLPDISIEFLVIDFDRTVKNQVIGRVILGAHSVTANGVEHWREVCENPRKPVAKWHCLSE 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 55/125 (44%)
C2B_Synaptotagmin-1 326..461 CDD:176047 60/136 (44%)
syt11XP_031747300.1 C2A_Synaptotagmin-4-11 156..282 CDD:176034 55/125 (44%)
C2B_Synaptotagmin-4 291..428 CDD:176049 60/137 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.