DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt1 and syt6a

DIOPT Version :9

Sequence 1:NP_523460.2 Gene:Syt1 / 33473 FlyBaseID:FBgn0004242 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_017209198.1 Gene:syt6a / 100149310 ZFINID:ZDB-GENE-090601-2 Length:537 Species:Danio rerio


Alignment Length:306 Identity:141/306 - (46%)
Similarity:214/306 - (69%) Gaps:10/306 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 KVQPDM--EELTENAEEGDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSD 229
            :::|::  :..|||.|..   :.:..:..|::||.|.||:.:..|.|.:::|.:|||.|:.|:||
Zfish   214 RIKPELYKQMTTENDESA---NSKGGKNCGKINFSLRYDYENEMLLVKILKAFDLPAKDLCGSSD 275

  Fly   230 PYVKVYLLPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGE 294
            ||||:|||||:|:||:|:||||||:|.|:|:|.| .:||.:...:.|..::|||||||:||.|||
Zfish   276 PYVKIYLLPDRKQKFQTRVHRKTLNPTFDESFQF-PVPYDELAVRKLHLSVFDFDRFSRHDMIGE 339

  Fly   295 VKVP-LCTI-DLAQTIEEWRDLVSVEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDV 357
            |.:. |..: ||::....|||:.....|  ...||:|.|||.|:||||:||:.:::.:|||.||:
Zfish   340 VILDNLFEVSDLSRETSIWRDIQYATSE--SVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDI 402

  Fly   358 GGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGT 422
            .|.||||||::::.:|:|||||||:.||.||||.|||:..|::|.|.:.::.|.::|:|||.:|.
Zfish   403 TGYSDPYVKVSLICDGRRLKKKKTTTKKNTLNPTYNEAIIFDIPPESMDQVSLHISVMDYDLVGH 467

  Fly   423 SEPIGRCILGCMGTGTELRHWSDMLASPRRPIAQWHTLKDPEETDE 468
            :|.||.|.|||...|....||::|||.||:|||.||.|.:.::|::
Zfish   468 NEIIGVCRLGCGAEGLGRDHWNEMLAYPRKPIAHWHPLLESKKTEK 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt1NP_523460.2 Podoplanin 5..136 CDD:283467
C2A_Synaptotagmin-1-5-6-9-10 192..316 CDD:176031 62/125 (50%)
C2B_Synaptotagmin-1 326..461 CDD:176047 71/134 (53%)
syt6aXP_017209198.1 C2A_Synaptotagmin-1-5-6-9-10 238..363 CDD:176031 62/125 (50%)
C2B_Synaptotagmin-3-5-6-9-10 372..505 CDD:176048 70/132 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394604at33208
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X85
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.