DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and YPT10

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_009823.2 Gene:YPT10 / 852567 SGDID:S000000468 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:42/236 - (17%)
Similarity:82/236 - (34%) Gaps:70/236 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TVRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPS 75
            |:::::|||..|||||:...:.:.:.. ...:.|:|...                 .|.|...||
Yeast     4 TIKVVLLGDSSVGKTSIVTRLKSGKFL-AKHAATIGAAF-----------------ITKTIEVPS 50

  Fly    76 SSEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQR-----ESFYKNIDGIVLVYNMLELS 135
            :...:|...:|..                   |....|:|     ..:|::.:..::|:.:.::|
Yeast    51 NDSSTEKRIHMEI-------------------WDTAGQERYKSLVPMYYRDANIALIVFELGDVS 96

  Fly   136 SQDSLHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLRRRGSIAHQLNVEEM 200
            |......|..|          |:.|:    ....:::||...|.:..   ...|.:.....::.:
Yeast    97 SLQCAKTWFQD----------LQDRA----QGTQVIIVGNKYDLVCE---EHSGEVTIPAELQGL 144

  Fly   201 LVNCLDPQSFVDKSRNQGKLYGFLNRVIEF---KEQFPLLS 238
                    .:|..|...|..:..||::|..   :.||..||
Yeast   145 --------PYVAVSAKTGYNFDTLNKIIISLVPESQFKTLS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 36/221 (16%)
YPT10NP_009823.2 Rab 5..158 CDD:206640 34/214 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2695
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.