DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and SEC4

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:46/236 - (19%)
Similarity:86/236 - (36%) Gaps:89/236 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            ::||::||.||||:.|.                         ||.                    
Yeast    21 MKILLIGDSGVGKSCLL-------------------------VRF-------------------- 40

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLNSD------WRMCRQQR-----ESFYKNIDGIVLVYN 130
            .||..|..::    ||..|.:.::..|:|..      |....|:|     .::|:...||:|||:
Yeast    41 VEDKFNPSFI----TTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYD 101

  Fly   131 MLELSSQDSLHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLRRRG-SIAHQ 194
            :.:..:..::..|    .:.:.:|         .|..|.:|:||...|...|.....:| ::|.:
Yeast   102 VTDERTFTNIKQW----FKTVNEH---------ANDEAQLLLVGNKSDMETRVVTADQGEALAKE 153

  Fly   195 LNVEEMLVNCLDPQSFVDKSR----NQGKLYGFLNRVIEFK 231
            |.:           .|::.|.    |..:::..|.::|:.|
Yeast   154 LGI-----------PFIESSAKNDDNVNEIFFTLAKLIQEK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 44/232 (19%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 45/234 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.