DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and RAB8C

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_195972.1 Gene:RAB8C / 831817 AraportID:AT5G03520 Length:216 Species:Arabidopsis thaliana


Alignment Length:217 Identity:43/217 - (19%)
Similarity:82/217 - (37%) Gaps:85/217 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            :::|::||.||||:.|                            |..:|       ..|:||   
plant    16 IKLLLIGDSGVGKSCL----------------------------LLRFS-------DDTFTT--- 42

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLNSD------WRMCRQQR-----ESFYKNIDGIVLVYN 130
                       |..||..|.:.:...:|:..      |....|:|     .::|:...||:|||:
plant    43 -----------SFITTIGIDFKIRTVELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYD 96

  Fly   131 MLELSSQDSLHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRR-PLRRRGSIAHQ 194
            :.:.||.:::.:|    ::.|.:|....:..||..:.|       ::|:..|. |..:..::|.:
plant    97 VTDESSFNNIRNW----MKNIEQHASDNVNKILVGNKA-------DMDESKRAVPTAKGQALADE 150

  Fly   195 -------------LNVEEMLVN 203
                         ||||.:.::
plant   151 YGIKFFETSAKTNLNVENVFMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 43/217 (20%)
RAB8CNP_195972.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 43/217 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.