DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and AT5G09910

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001318521.1 Gene:AT5G09910 / 830852 AraportID:AT5G09910 Length:333 Species:Arabidopsis thaliana


Alignment Length:183 Identity:44/183 - (24%)
Similarity:77/183 - (42%) Gaps:58/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            :|:|::||.||||:||.:|:........| |:|:|   ..|.|:...|:.|.           ||
plant    23 IRVLVVGDSGVGKSSLVHLIVKGSSIVRP-SQTIG---CTVGVKHLTYASPA-----------SS 72

  Fly    77 SE----DSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQ 137
            |.    |||..             :|||.:|::...|. :..|..||..|:|::.|:::.:.:::
plant    73 SSIIKGDSERD-------------FFVELWDVSGHERY-KDCRSLFYSQINGVIFVHDLSQRTTK 123

  Fly   138 DSLHDWLYDPLRQICKHRHLRIRSILKNHNAPI------------LVVGTNLD 178
            .:|..|..:.             |:....:||:            :|:|...|
plant   124 TNLQKWAGEV-------------SVTGEFSAPLSSGGPGGLPVPYIVIGNKAD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 44/183 (24%)
AT5G09910NP_001318521.1 PLN00023 2..333 CDD:177661 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.