DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and Rabl3

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001035964.1 Gene:Rabl3 / 67657 MGIID:1914907 Length:236 Species:Mus musculus


Alignment Length:248 Identity:69/248 - (27%)
Similarity:114/248 - (45%) Gaps:51/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            |::|:|||.||||:||.:|:...::...| |.|||   ..|.:|:|:|.:     .||...|   
Mouse     7 VKVLVLGDSGVGKSSLVHLLCHNQVLGNP-SWTVG---CSVDIRVHDYKE-----GTPEEKT--- 59

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLN---SDWRMCRQQRESFYKNIDGIVLVYNMLELSSQD 138
                                |::|.:|:.   ......:..|..||.:::||:||:::....|..
Mouse    60 --------------------YYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQ 104

  Fly   139 SLHDWLYDPLRQICKHRHLRI------RSILKNHNAPILVVGTNLDKL----MRRPLRRRGSIAH 193
            :|:.|..:.|.:......:.:      |....::..|:||:||.||::    ....|.|...:|.
Mouse   105 NLYRWSLEVLNRDAVPTGVLVTNGDYDREQFADNQIPLLVIGTKLDQIHETKRHEVLIRTAFLAE 169

  Fly   194 QLNVEEMLVNCLDPQSFVDKSRNQGKLYGFLNRVIE----FKE--QFPLLSFR 240
            ..|.||:.::|.:|:|....|.|..||..|.::|||    |:|  |.|..|.|
Mouse   170 DFNAEEINLDCTNPRSSAAGSSNAVKLSRFFDKVIEKRYFFREGNQIPGFSDR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 61/229 (27%)
Rabl3NP_001035964.1 Small GTPase-like 1..235 69/248 (28%)
RabL3 7..210 CDD:206689 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.820

Return to query results.
Submit another query.