DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and Rab18

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:206 Identity:44/206 - (21%)
Similarity:70/206 - (33%) Gaps:73/206 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEE--SWHVQVRLHEYSKPVILPPTPTWTTP 74
            :::|::|:.||||:||.......:.....|. |:|.:  |..:||...:|.       ...|.|.
  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDV-TIGMDFKSKVMQVDGIDYK-------VALWDTA 62

  Fly    75 SSSEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDS 139
            .:..      :...||                          |||:...|.:|||::....|...
  Fly    63 GAER------FRSLTP--------------------------SFYRKALGAILVYDITSRDSLVK 95

  Fly   140 LHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLRRRGSIAHQLNVEEMLVNC 204
            |..||.:            :.|...|.|..|:|||..:|                   ||.:|:.
  Fly    96 LETWLAE------------LDSYSDNPNIAIIVVGNKID-------------------EERVVDR 129

  Fly   205 LDPQSFVDKSR 215
            .:.:.|..|.|
  Fly   130 EEGRKFARKHR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 44/206 (21%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 44/206 (21%)
Rab18 6..165 CDD:206656 44/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.