DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and rabl3

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_991296.1 Gene:rabl3 / 403048 ZFINID:ZDB-GENE-040808-11 Length:233 Species:Danio rerio


Alignment Length:231 Identity:58/231 - (25%)
Similarity:103/231 - (44%) Gaps:45/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            |::|:|||.||||:||.:|:...::...| |.|||   ..|.||:|:|.:          .||..
Zfish     7 VKVLVLGDSGVGKSSLVHLLCQNQVLGNP-SWTVG---CSVDVRVHDYRE----------GTPEE 57

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLN---SDWRMCRQQRESFYKNIDGIVLVYNMLELSSQD 138
            .                  .:::|.:|:.   ......:..|..||.:::||:||:::....|..
Zfish    58 K------------------AFYIELWDVGGSVGSASSVKSTRAVFYNSVNGIILVHDLTNKKSSQ 104

  Fly   139 SLHDWLYDPLRQICKHRHLRI------RSILKNHNAPILVVGTNLDKLMRRP----LRRRGSIAH 193
            :|:.|..:.|.:......:.:      |.....:..|:|::||..|::....    |.|...::.
Zfish   105 NLYRWSLEALSKDSSPTGIIVSNGDYDREQFAENAVPLLLIGTKFDQIPENKRNDVLTRTAFLSE 169

  Fly   194 QLNVEEMLVNCLDPQSFVDKSRNQGKLYGFLNRVIE 229
            ..|.||:.::|.:|:.....|.|..||..|.::|||
Zfish   170 DFNAEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 56/229 (24%)
rabl3NP_991296.1 Small GTPase-like 1..233 58/231 (25%)
RabL3 7..210 CDD:206689 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.