DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and Y116A8C.10

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001122804.1 Gene:Y116A8C.10 / 3565140 WormBaseID:WBGene00013790 Length:248 Species:Caenorhabditis elegans


Alignment Length:256 Identity:57/256 - (22%)
Similarity:94/256 - (36%) Gaps:93/256 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVPTVRILMLGDRGVGKTSLTNLMATTEITP----TPDSRTVGEE---SWHVQVRLHEYSKPVIL 65
            |..:.:||:|||..||||||.:.:|.....|    :.|| |:|..   :||              
 Worm     5 DESSTKILVLGDSCVGKTSLCHCIAGGGEPPGGGRSFDS-TIGATVVMAWH-------------- 54

  Fly    66 PPTPTWTTPSSSEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMC--RQQRESFYKNIDGIVLV 128
                              .|...||.....|  :|.:|:..   |.  ||..:.|::...|.:||
 Worm    55 ------------------EYRAGTPEQRTEL--LELWDIGG---MVAHRQAAQVFFEGAVGAILV 96

  Fly   129 YNMLELSSQDSLHDWL---------------YDPLRQICKHRHLRIRSILKNHNAPILVVGTNLD 178
            :::....|:::|..||               .||..       :.::..:::.|.|:|:|||..|
 Worm    97 HDLTNKRSEENLATWLTMLDGKPRGAAPKSSKDPAA-------VALKVDIESCNIPVLIVGTKAD 154

  Fly   179 KLMRR-------------PLRRRGSIAHQLNVEEMLVNCLD----------PQSFVDKSRN 216
            .:..:             .:..||| |:.:.:.....:|||          ..||..|.|:
 Worm   155 LVPHKGPVSYDRLHIDSLKIILRGS-ANSITLSRFFDSCLDRTRRTSLNSSSSSFFTKPRS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 56/252 (22%)
Y116A8C.10NP_001122804.1 P-loop_NTPase 10..195 CDD:304359 51/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.