DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and CG4789

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_573166.1 Gene:CG4789 / 32668 FlyBaseID:FBgn0030792 Length:274 Species:Drosophila melanogaster


Alignment Length:253 Identity:75/253 - (29%)
Similarity:107/253 - (42%) Gaps:68/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            |||:::||.||||||||:|:...|....| ..|||   .::||::|.:.:..             
  Fly     7 VRIVVVGDSGVGKTSLTHLITHNEALIRP-GWTVG---CNIQVKMHPFREGT------------- 54

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDSLH 141
                     .|..|      ||||.:|:...... :..|..||..||||:||:::....||..|.
  Fly    55 ---------ARECP------YFVELFDVGGSLNH-KNTRSVFYAGIDGIILVHDLTNAKSQRQLI 103

  Fly   142 DWLYD-----------------------PLRQICK-------HRHLRIRSILKNHNAPILVVGTN 176
            ||||:                       ||.....       |....:...|.....||||:||.
  Fly   104 DWLYEIVNKEGKDTNKSNGASMPPSPPSPLSSFSTDNLGTDGHILFDMEEFLGATQTPILVMGTK 168

  Fly   177 LDKL--MRRP---LRRRGSIAHQLNVEEMLVNCLDPQSFVDKSRNQGKLYGFLNRVIE 229
            ||.|  .|.|   :::.|.||.:...||:.:||.:.:|....:.:..||..|.:||||
  Fly   169 LDLLDEKRHPKMGVKKPGGIADKCGAEEIWLNCRNSRSLAAGTTDAVKLSRFFDRVIE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 73/251 (29%)
CG4789NP_573166.1 P-loop_NTPase 7..228 CDD:304359 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2695
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.