DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and Rab9Fb

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_727472.1 Gene:Rab9Fb / 32029 FlyBaseID:FBgn0052670 Length:214 Species:Drosophila melanogaster


Alignment Length:181 Identity:40/181 - (22%)
Similarity:70/181 - (38%) Gaps:65/181 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RILMLGDRGVGKTSLTNLMATTEITPTPDSR-------TVGEESWHVQVRLHEYSKPVILPPTPT 70
            :||:|||.||||:.|  ||..:      |:|       |||.:   .:||..|.:..:::     
  Fly     9 KILVLGDIGVGKSCL--LMRFS------DNRFTEKHVCTVGMD---FRVRNVELAGRMVM----- 57

  Fly    71 WTTPSSSEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELS 135
                                        ::.:|...|.|. :....|:|:...||:|||::....
  Fly    58 ----------------------------LQIWDTAGDERF-KSLLPSYYRGAHGILLVYDITSSK 93

  Fly   136 SQDSLHDWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLR 186
            |..::..||.:..|             :.:.:..:::||...|.|..|.:|
  Fly    94 SFRNIDGWLKEIRR-------------MSSESVNVMLVGNKCDDLDNRQVR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 40/181 (22%)
Rab9FbNP_727472.1 RAB 8..171 CDD:197555 40/181 (22%)
Rab 8..165 CDD:206640 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.