DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and Rab9Db

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_572642.1 Gene:Rab9Db / 31993 FlyBaseID:FBgn0030221 Length:197 Species:Drosophila melanogaster


Alignment Length:213 Identity:49/213 - (23%)
Similarity:81/213 - (38%) Gaps:56/213 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RILMLGDRGVGKTSLTNLMATTEITPTPDSR-TVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            :|::|||.|||||.|  ||..::...|...| |||.:.....|...::....:|   ..|.|   
  Fly     9 KIIILGDSGVGKTCL--LMRFSDNQFTERHRVTVGMDRRECSVEFADWRMGRML---QVWDT--- 65

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDSLH 141
             .|.|.:..:::|                    .||        :..||:|||::....|..::.
  Fly    66 -SDDERFKLLKAT--------------------QCR--------SAHGILLVYDITSSKSFQNID 101

  Fly   142 DWLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLRRRGSIAHQLNVEEMLVNCLD 206
            .|:.: :|::|..:            ..:|:||...|.    |..|:.|:|...|.......|.:
  Fly   102 GWMKE-IRRLCPDK------------VTVLLVGNKSDD----PNHRQVSMAQGFNYAHRQSICFE 149

  Fly   207 PQSFVDKSRNQGKLYGFL 224
            ..| ....||...::..|
  Fly   150 EVS-AKSGRNVYDIFSSL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 49/213 (23%)
Rab9DbNP_572642.1 RAB 8..171 CDD:197555 49/213 (23%)
Rab 8..167 CDD:206640 49/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2695
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.