DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and RabX2

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_572627.1 Gene:RabX2 / 31971 FlyBaseID:FBgn0030200 Length:195 Species:Drosophila melanogaster


Alignment Length:196 Identity:42/196 - (21%)
Similarity:76/196 - (38%) Gaps:63/196 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSSS 77
            ::|:|||.||||:.|....:....| ....||:|     :.|:                      
  Fly     9 KVLVLGDSGVGKSCLLMRFSDDRFT-EKYLRTMG-----IDVK---------------------- 45

  Fly    78 EDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDSLHD 142
                    .||....:.:: .::.:|.:.|.|. .....|.|::..||:|||::....|..::..
  Fly    46 --------ARSVELVSRVM-MLQVWDTSGDKRF-NSLMPSNYRSAHGILLVYDITSSKSFQNIDG 100

  Fly   143 WLYDPLRQICKHRHLRIRSILKNHNAPILVVGTNLDKLMRRPLRRRGSI------AHQ--LNVEE 199
            |:.: :|::|..:            ..:|:||...|.    |..|:.|:      ||:  |..||
  Fly   101 WMKE-IRRMCPDK------------VTVLLVGNKSDD----PNHRQVSMEQGFNYAHRGALGFEE 148

  Fly   200 M 200
            :
  Fly   149 V 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 42/196 (21%)
RabX2NP_572627.1 RAB 8..171 CDD:197555 42/196 (21%)
Rab 8..165 CDD:206640 42/196 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.