DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and ypt2

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_594580.1 Gene:ypt2 / 2543280 PomBaseID:SPAC9E9.07c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:28/143 - (19%)
Similarity:52/143 - (36%) Gaps:60/143 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            :::|::||.||||:.|  |:..:|.:.||                                    
pombe    10 IKLLLIGDSGVGKSCL--LLRFSEDSFTP------------------------------------ 36

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLNSD------WRMCRQQR-----ESFYKNIDGIVLVYN 130
                       |..||..|.:.:...:|:..      |....|:|     .::|:...||:|:|:
pombe    37 -----------SFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYD 90

  Fly   131 MLELSSQDSLHDW 143
            :.:..|.|::..|
pombe    91 VTDKKSFDNVRTW 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 28/143 (20%)
ypt2NP_594580.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 28/143 (20%)
Ras 11..172 CDD:278499 28/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.